In Stock

Combinal Dye Blue-Black 15ml

No. 2 BLUE/BLACK. Intense color with shimmering tones . One of the most favourite colors in the range because it suits many skin types. Suitable for eyelashes and eyebrows.

LOGIN TO SEE PRICE
SKU: COMBLB Category: Tag:
Brand:Combinal

Description

No. 2 BLUE/BLACK. Intense color with shimmering tones . One of the most favourite colors in the range because it suits many skin types. Suitable for eyelashes and eyebrows.

Quick Comparison

SettingsCombinal Dye Blue-Black 15ml removeCombinal Eye Make-Up Remover 125Ml removeFoot Expertise Destresser Foamer 150Ml removeFoot Expertise Kerato Scratcher - 75Ml removeFoot Expertise Hydra Recharge - 75Ml removeCombinal Dye Grey 15Ml remove
NameCombinal Dye Blue-Black 15ml removeCombinal Eye Make-Up Remover 125Ml removeFoot Expertise Destresser Foamer 150Ml removeFoot Expertise Kerato Scratcher - 75Ml removeFoot Expertise Hydra Recharge - 75Ml removeCombinal Dye Grey 15Ml remove
ImageCombinal Dye Blue-Black 15mlCombinal Eye Make-Up Remover 125MlFoot Expertise Destresser Foamer 150MlFoot Expertise Kerato Scratcher - 75MlFoot Expertise Hydra Recharge - 75MlCombinal Dye Grey 15Ml
SKUCOMBLBCOMREMOVERFEHWDESTFEPPSKESCFEPPSHYRECOMGR
Rating
Price
Stock
Availability
Add to cart

Read moreLOGIN TO SEE PRICE

Read moreLOGIN TO SEE PRICE

Read moreLOGIN TO SEE PRICE

Read moreLOGIN TO SEE PRICE

Read moreLOGIN TO SEE PRICE

Read moreLOGIN TO SEE PRICE

DescriptionNo. 2 BLUE/BLACK. Intense color with shimmering tones . One of the most favourite colors in the range because it suits many skin types. Suitable for eyelashes and eyebrows.The Combinal Eye Make?up Remover is a gentle cleanser especially for the sensitive eye area. The formula is enriched with active ingredients and cleansing agents which help to thoroughly remove eye make?up and soothe the sensitive skin around the eyes. This product cleanses without leaving an oily film on the skin thus reduces the risk of eye irritation.DeStresser revitalizing mousse for feet, ankles, legs. A refreshing and invigorating lotion ideal to alleviate conditions of heaviness, swelling, puffiness, weariness, at the end of demanding working days, after sport activities, or simply caused by hot weather or tight shoes. The calming and hydrating emulsion immediately relieves itching, stinging, redness and warming-up sensations. The special quickly absorbed mousse texture, newest trend in beauty care cosmetics, leaves the skin smooth, elastic and immediately dry, without leaving any residues or greasy coating on the epidermis surface. The BIOMIMETIC PEPTIDE and SODIUM HYALURONATE act as powerful humectants. MENTHOL, with its long-lasting freshness and energy sensation, exerts a decongestant, astringent and vessel-constricting action. Ingredients: Biomimetic Peptide Acetyl Hexapeptide-49 | Sodium Hyaluronate | Menthol. Approved by your skin: Free from PARABENS | SLS/SLES | SILICONS | PEG/PPG | MINERAL OILS | COLORING AGENTSFragrance free. Suitable for all foot skin types.Kerato Scratcher, chemical exfoliator. A gentle peeling cream ideal to remove dead cells and unpleasant scales from the upper layers of skin surface, allowing a more effective cell renewal and preparing the feet for subsequent treatments. Besides removing old cells and horny debris from the skin, keratolysis stimulates circulation and rough skin is helped to become smooth and soft. With SALICYLIC ACID, a highly effective keratolytic agent, removing skin cells from the stratum corneum, and facilitating penetration of XpertMoist® a powerful supply of hydrationfor the skin, leaving the feet supple and extra hydrated. A frequent use helps to reduce the chronic thickening of the skin. Ingredients: XpertMoist® (Pseudoalteromonas Ferment Extract Proline Alanine Serine) | Salicylic Acid. Approved by your skin: Free from PARABENS | SLS/SLES | SILICONS | ALCOHOL | PEG/PPG | MINERAL OILS | COLOURING AGENTS.Suitable for all foot skin types.Hydra Recharge, regenerating cream for dry to very dry feet. A restoring and reconditioning treatment exerting a moisturizing, soothing and nourishing action on the deeper layers of the skin, to soften dry to very-dry feet,minimizing the risk of fissures and effective against skin desquamation and irritation.Ideal for dryness occurring in geriatric feet. The blend of vegetal oils, combined with the emollient complex XpertMoist® supports long-lasting hydration,minimizing Trans Epidermal Water Loss and controlling xeroderma. VITAMIN E contributes to skin softness, elasticity and restructuring. Ingredients: XpertMoist® (Pseudoalteromonas Ferment Extract Proline Alanine Serine)Vitamin E | Blend of Vegetal Oils. Approved by your skin: Free from PARABENS | SLS/SLES | SILICONS | ALCOHOL | PEG/PPG | MINERAL OILS | COLOURING AGENTS. Suitable for all foot skin types, also for skins affected by diabetes and dermatitis.No. 6 LIGHT CHARCOAL. A dark shade for a natural coverage of grey hair. Perfect for covering grey or white hair or leaving a darker effect if left for a longer processing time. Can be mixed with any other COMBINAL Eyelash dye. Suitable for eyelashes and eyebrow.
ContentNo. 2 BLUE/BLACK. Intense color with shimmering tones . One of the most favourite colors in the range because it suits many skin types. Suitable for eyelashes and eyebrows.The Combinal Eye Make?up Remover is a gentle cleanser especially for the sensitive eye area. The formula is enriched with active ingredients and cleansing agents which help to thoroughly remove eye make?up and soothe the sensitive skin around the eyes. This product cleanses without leaving an oily film on the skin thus reduces the risk of eye irritation.DeStresser revitalizing mousse for feet, ankles, legs. A refreshing and invigorating lotion ideal to alleviate conditions of heaviness, swelling, puffiness, weariness, at the end of demanding working days, after sport activities, or simply caused by hot weather or tight shoes. The calming and hydrating emulsion immediately relieves itching, stinging, redness and warming-up sensations. The special quickly absorbed mousse texture, newest trend in beauty care cosmetics, leaves the skin smooth, elastic and immediately dry, without leaving any residues or greasy coating on the epidermis surface. The BIOMIMETIC PEPTIDE and SODIUM HYALURONATE act as powerful humectants. MENTHOL, with its long-lasting freshness and energy sensation, exerts a decongestant, astringent and vessel-constricting action. Ingredients: Biomimetic Peptide Acetyl Hexapeptide-49 | Sodium Hyaluronate | Menthol. Approved by your skin: Free from PARABENS | SLS/SLES | SILICONS | PEG/PPG | MINERAL OILS | COLORING AGENTSFragrance free. Suitable for all foot skin types.Kerato Scratcher, chemical exfoliator. A gentle peeling cream ideal to remove dead cells and unpleasant scales from the upper layers of skin surface, allowing a more effective cell renewal and preparing the feet for subsequent treatments. Besides removing old cells and horny debris from the skin, keratolysis stimulates circulation and rough skin is helped to become smooth and soft. With SALICYLIC ACID, a highly effective keratolytic agent, removing skin cells from the stratum corneum, and facilitating penetration of XpertMoist® a powerful supply of hydrationfor the skin, leaving the feet supple and extra hydrated. A frequent use helps to reduce the chronic thickening of the skin. Ingredients: XpertMoist® (Pseudoalteromonas Ferment Extract Proline Alanine Serine) | Salicylic Acid. Approved by your skin: Free from PARABENS | SLS/SLES | SILICONS | ALCOHOL | PEG/PPG | MINERAL OILS | COLOURING AGENTS.Suitable for all foot skin types.Hydra Recharge, regenerating cream for dry to very dry feet. A restoring and reconditioning treatment exerting a moisturizing, soothing and nourishing action on the deeper layers of the skin, to soften dry to very-dry feet,minimizing the risk of fissures and effective against skin desquamation and irritation.Ideal for dryness occurring in geriatric feet. The blend of vegetal oils, combined with the emollient complex XpertMoist® supports long-lasting hydration,minimizing Trans Epidermal Water Loss and controlling xeroderma. VITAMIN E contributes to skin softness, elasticity and restructuring. Ingredients: XpertMoist® (Pseudoalteromonas Ferment Extract Proline Alanine Serine)Vitamin E | Blend of Vegetal Oils. Approved by your skin: Free from PARABENS | SLS/SLES | SILICONS | ALCOHOL | PEG/PPG | MINERAL OILS | COLOURING AGENTS. Suitable for all foot skin types, also for skins affected by diabetes and dermatitis.No. 6 LIGHT CHARCOAL. A dark shade for a natural coverage of grey hair. Perfect for covering grey or white hair or leaving a darker effect if left for a longer processing time. Can be mixed with any other COMBINAL Eyelash dye. Suitable for eyelashes and eyebrow.
WeightN/AN/AN/AN/AN/AN/A
DimensionsN/AN/AN/AN/AN/AN/A
Additional information